BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP18_F_O02
(1224 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 33 0.061
>SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3
|Schizosaccharomyces pombe|chr 3|||Manual
Length = 732
Score = 33.5 bits (73), Expect = 0.061
Identities = 20/49 (40%), Positives = 27/49 (55%)
Frame = +2
Query: 302 SNAPARNRRAFEDMPPTRPDTSGRPKLVLEKRTVKEPVNSLASTSQSSS 448
+ A A N R+ ED P P TS R + L K+ + PV+S ST +SS
Sbjct: 660 ARASALNARSEEDFPALPPSTSKRISVQLGKKQAR-PVDSWGSTPNTSS 707
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,944,076
Number of Sequences: 5004
Number of extensions: 71118
Number of successful extensions: 171
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 171
length of database: 2,362,478
effective HSP length: 74
effective length of database: 1,992,182
effective search space used: 663396606
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -