SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP18_F_F23
         (1201 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY534996-1|AAT07394.1|  471|Anopheles gambiae XK-related b protein.    28   0.62 
L04753-1|AAA29357.1|  511|Anopheles gambiae alpha-amylase protein.     24   7.7  

>AY534996-1|AAT07394.1|  471|Anopheles gambiae XK-related b protein.
          Length = 471

 Score = 27.9 bits (59), Expect = 0.62
 Identities = 14/51 (27%), Positives = 23/51 (45%)
 Frame = -2

Query: 363 TSFFPLMIAGVVAIKTSSYLCQLLFIFFVSLNIYQGQRYDGFEVWIMFRSF 211
           T F PL       I  + Y C ++F   +   +Y+ Q++  F   I+  SF
Sbjct: 69  TEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQKFAYFAAVIVIVSF 119


>L04753-1|AAA29357.1|  511|Anopheles gambiae alpha-amylase protein.
          Length = 511

 Score = 24.2 bits (50), Expect = 7.7
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 202 GDPEATEHDPHF 237
           G P A +HDPHF
Sbjct: 17  GRPVAAQHDPHF 28


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 964,210
Number of Sequences: 2352
Number of extensions: 19003
Number of successful extensions: 74
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 71
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 74
length of database: 563,979
effective HSP length: 66
effective length of database: 408,747
effective search space used: 136112751
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -