SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP18_F_A15
         (1262 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC12C2.09c |||Haemolysin-III family protein|Schizosaccharomyce...    26   9.6  
SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha...    26   9.6  

>SPBC12C2.09c |||Haemolysin-III family protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 324

 Score = 26.2 bits (55), Expect = 9.6
 Identities = 11/15 (73%), Positives = 11/15 (73%)
 Frame = +2

Query: 608 CSCFYATIC*HSDDV 652
           CS FY TI  HSDDV
Sbjct: 139 CSTFYHTISNHSDDV 153


>SPAC4F8.11 |||WD repeat protein, human WDR24
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 846

 Score = 26.2 bits (55), Expect = 9.6
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 10/52 (19%)
 Frame = +2

Query: 419 LLNKAASI-NITCREVKWNSGSVFC*LYDC---------EVHIKCVLYDYSE 544
           LL K+    +I+C +VKW S      ++ C         +V+++ +LYD++E
Sbjct: 81  LLQKSTQTKHISCNDVKWGSSFASNLIFTCSPLGNLNVWDVNLEALLYDFNE 132


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,583,473
Number of Sequences: 5004
Number of extensions: 48903
Number of successful extensions: 87
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 87
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 87
length of database: 2,362,478
effective HSP length: 75
effective length of database: 1,987,178
effective search space used: 685576410
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -