BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP17_F_P13
(972 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 22 8.3
>DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped
protein.
Length = 126
Score = 21.8 bits (44), Expect = 8.3
Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
Frame = +3
Query: 114 KYGTR-YGASLRKMVKKMEVTQHAKYTCSFCGK 209
KY R + S ++ + T Y+C CGK
Sbjct: 83 KYCNRQFTKSYNLLIHERTHTDERPYSCDICGK 115
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,333
Number of Sequences: 336
Number of extensions: 2236
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 27513178
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -