Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP17_F_L11
         (885 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0224 - 21059328-21059888,21060388-21060462,21060715-210607...    31   0.93 

>02_04_0224 -
           21059328-21059888,21060388-21060462,21060715-21060798,
           21060866-21061183,21061511-21061722,21061766-21062030
          Length = 504

 Score = 31.5 bits (68), Expect = 0.93
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 8/69 (11%)
 Frame = +3

Query: 180 MWRRYLLWFAHEHVDFRHAEINSILSLF-------KIPIKFIEKPCLEKPYWIVELPSED 338
           MW  YL  F H  +D+R  E+ S+  LF        +  +  E   ++ P+ +V LP ++
Sbjct: 1   MW--YLCVFYHRLLDYRRPEVQSLAELFGGPGAGDAVEWRMPENHHVDSPFHLVRLPGDE 58

Query: 339 -CAKKIASR 362
             A +IA+R
Sbjct: 59  RLAAQIANR 67


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,767,477
Number of Sequences: 37544
Number of extensions: 211024
Number of successful extensions: 398
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 398
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2503236492
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)