Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP17_F_K13
         (1230 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY745206-1|AAU93473.1|   91|Anopheles gambiae cytochrome P450 pr...    24   7.9  

>AY745206-1|AAU93473.1|   91|Anopheles gambiae cytochrome P450
           protein.
          Length = 91

 Score = 24.2 bits (50), Expect = 7.9
 Identities = 14/44 (31%), Positives = 15/44 (34%)
 Frame = -3

Query: 385 FPRXSRLAPXRXXWAVGGXXPVXLSPXGLXPRACLXXRXXXPLS 254
           FP      P R         P    P GL PR C+  R    LS
Sbjct: 23  FPEPEVYMPQRFDEQAPNYDPDAYYPFGLGPRNCIGLRQGIMLS 66


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.304    0.133    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 543,107
Number of Sequences: 2352
Number of extensions: 5322
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 66
effective length of database: 408,747
effective search space used: 140200221
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 43 (21.8 bits)