SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP17_F_G21
         (894 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    24   1.6  
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          22   8.7  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      22   8.7  

>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +1

Query: 64  KSKSLNFNE*NLQREASILVQNCVL*INTKYIFEITMS 177
           KS+  N N+  +  E S++V N    INT     I+MS
Sbjct: 813 KSEEKNINDHCVTTEQSVVVTNVTTTINTPTTSVISMS 850


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 241 KFFLESSNWQLDV 279
           K+F E  NW LD+
Sbjct: 538 KYFYEIDNWMLDL 550


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 241 KFFLESSNWQLDV 279
           K+F E  NW LD+
Sbjct: 538 KYFYEIDNWMLDL 550


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 210,922
Number of Sequences: 438
Number of extensions: 3840
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -