Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP16_F_I09
         (871 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A2E5Q0 Cluster: IQ calmodulin-binding motif family prot...    33   7.1  

>UniRef50_A2E5Q0 Cluster: IQ calmodulin-binding motif family
           protein; n=1; Trichomonas vaginalis G3|Rep: IQ
           calmodulin-binding motif family protein - Trichomonas
           vaginalis G3
          Length = 1518

 Score = 33.5 bits (73), Expect = 7.1
 Identities = 17/57 (29%), Positives = 25/57 (43%)
 Frame = -2

Query: 669 TSSPQY*DTNMFLLSCKLLHRKVTQSYNTIQSAYLIVKFNTYLLVRHNREFMLHTHD 499
           TS   Y  TN  L+   L H KVTQ         + + FN +L +      + H+H+
Sbjct: 169 TSFNTYMKTNFLLMKPSLNHEKVTQVVVNFNKPRISLFFNAWLQISQEHSVLKHSHE 225


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 775,863,427
Number of Sequences: 1657284
Number of extensions: 15117896
Number of successful extensions: 28935
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 27935
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28915
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 77472727479
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)