BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP16_F_D02
(1046 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U53336-10|AAA96182.2| 125|Caenorhabditis elegans Hypothetical p... 29 7.3
>U53336-10|AAA96182.2| 125|Caenorhabditis elegans Hypothetical
protein K07C11.10 protein.
Length = 125
Score = 28.7 bits (61), Expect = 7.3
Identities = 18/47 (38%), Positives = 25/47 (53%)
Frame = -2
Query: 412 LERTTYTELRYLQREL*ESATLPEGRKADRYPVSGRVGTGERXEGAS 272
L+ T +L +QRE E +PEG+KA R P S + + EG S
Sbjct: 66 LKTITTQKLEKMQREQMERLQVPEGQKA-RTPESAEAESPKSNEGPS 111
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,367,676
Number of Sequences: 27780
Number of extensions: 263452
Number of successful extensions: 664
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 649
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 664
length of database: 12,740,198
effective HSP length: 82
effective length of database: 10,462,238
effective search space used: 2782955308
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -