Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP15_F_K19
         (922 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyce...    65   2e-11

>SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 83

 Score = 64.9 bits (151), Expect = 2e-11
 Identities = 30/64 (46%), Positives = 40/64 (62%)
 Frame = +2

Query: 143 NQLQRLVPHPHSSFMAVXVPWLLQAXNSFXSRTXXVVVCAGCSTILCQPTGGRAXLTEGC 322
           ++L++LV  P S FM V  P        F S    VV+C  C+++LCQPTGG+A L EGC
Sbjct: 19  HKLKQLVQGPRSFFMDVKCPGCFNITTVF-SHAQTVVICGSCASVLCQPTGGKARLMEGC 77

Query: 323 SFRK 334
           SFR+
Sbjct: 78  SFRR 81


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,110,130
Number of Sequences: 5004
Number of extensions: 27403
Number of successful extensions: 47
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 468512460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)