Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP15_F_I17
         (941 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1037 - 23438205-23441219,23443509-23444513,23444627-23446708     30   3.1  

>07_03_1037 - 23438205-23441219,23443509-23444513,23444627-23446708
          Length = 2033

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 15/44 (34%), Positives = 18/44 (40%)
 Frame = +1

Query: 688  LTSXTKIDXQXXGGXTRXXXKXSRRFPPGKXPRAPSXSHPAVYR 819
            L   T +D    GG  R      +R PP +  R  S   P VYR
Sbjct: 1462 LGEITTVDVNETGGGARSSLSFRQRMPPPRLQRCVSGILPVVYR 1505


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,777,618
Number of Sequences: 37544
Number of extensions: 167652
Number of successful extensions: 232
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 230
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 232
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2706104940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)