BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP15_F_I03
(953 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 7.1
AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 9.4
>DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine
receptor alpha9subunit protein.
Length = 431
Score = 22.2 bits (45), Expect = 7.1
Identities = 11/40 (27%), Positives = 22/40 (55%)
Frame = -3
Query: 822 RALAXLSYEVFMPNQASM*SNSEYGSLMISSV*NCCLPST 703
R + L + +F N AS+ +++E+G + + N P+T
Sbjct: 4 RIITALGFLLFWQNSASLENDNEFGFSYLLNCKNYDHPTT 43
>AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein.
Length = 735
Score = 21.8 bits (44), Expect = 9.4
Identities = 8/13 (61%), Positives = 11/13 (84%)
Frame = -2
Query: 418 VPKAMTGMNVPSR 380
VPK++ G+NV SR
Sbjct: 239 VPKSVAGLNVSSR 251
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 217,581
Number of Sequences: 438
Number of extensions: 4512
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 31323201
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -