Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP15_F_F24
         (912 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U50041-1|AAC50454.1| 1179|Homo sapiens signaling inositol polyph...    33   1.1  

>U50041-1|AAC50454.1| 1179|Homo sapiens signaling inositol
           polyphosphate 5 phosphatase SIP-145 protein.
          Length = 1179

 Score = 33.5 bits (73), Expect = 1.1
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = +3

Query: 279 AWRCLKSRFSSTRPLASPDWIHGRLAPSKQRPELIQNGR-STF*FRRRLKDTKEEAVCRY 455
           +W CL +R     P   P W HG +  SK    L + G+  +F  R     ++  A+C  
Sbjct: 26  SWGCLPARPRRPTPTMVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVL 85

Query: 456 FENFV 470
           + N V
Sbjct: 86  YRNCV 90


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,943,284
Number of Sequences: 237096
Number of extensions: 2452898
Number of successful extensions: 8488
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8302
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8488
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11825849886
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)