SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP14_F_M14.2
         (1331 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5DPB8 Cluster: Putative uncharacterized protein; n=1; ...    34   7.3  

>UniRef50_A5DPB8 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 189

 Score = 34.3 bits (75), Expect = 7.3
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = -3

Query: 309 ITXYNFTRPHKKH-QFSKKKRXIKIGSARRKTXKVTMAKKITXELRSAFCLKXVNKRSEN 133
           +T YN     KKH +  KKKR  KI   +R+  +  + KK+  E ++    K ++KR   
Sbjct: 109 LTEYNAKIKPKKHTRAGKKKRQAKIEGRKRREERNLVKKKLEEEAQARLLKKKLHKRGGK 168

Query: 132 DEK 124
             K
Sbjct: 169 KHK 171


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 214,935,253
Number of Sequences: 1657284
Number of extensions: 2396814
Number of successful extensions: 6763
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6630
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6755
length of database: 575,637,011
effective HSP length: 103
effective length of database: 404,936,759
effective search space used: 137678498060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -