SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP14_F_M12.2
         (1326 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0298 - 21733620-21733805,21733900-21734025,21734128-217342...    29   6.2  

>02_04_0298 -
           21733620-21733805,21733900-21734025,21734128-21734213,
           21734751-21734866,21734951-21735628,21736080-21736105
          Length = 405

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +1

Query: 256 DVAFTSRPVRKCYFCSKSCSSVKRRFFDTRTII 354
           D   T+     C+F    C  VKRRFFD  +I+
Sbjct: 356 DTGITNVQHDLCHFIHCECCHVKRRFFDPESIL 388


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,269,591
Number of Sequences: 37544
Number of extensions: 216798
Number of successful extensions: 377
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 374
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 377
length of database: 14,793,348
effective HSP length: 84
effective length of database: 11,639,652
effective search space used: 4155355764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -