SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP14_F_M08.2
         (1396 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli...    29   0.014
UniRef50_Q4RQM1 Cluster: Chromosome 2 SCAF15004, whole genome sh...    30   0.12 
UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote...    29   0.55 
UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ...    27   0.56 
UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere...    29   0.56 
UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ...    29   0.57 
UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos...    29   0.57 
UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh...    29   0.57 
UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ...    29   0.60 
UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh...    30   0.74 
UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu...    28   0.78 
UniRef50_Q9UQL5 Cluster: DEAD-box protein p72; n=15; Euteleostom...    28   0.85 
UniRef50_A3LZQ9 Cluster: Predicted protein; n=1; Pichia stipitis...    31   0.95 
UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=...    28   0.97 
UniRef50_Q2IG02 Cluster: Outer membrane protein, OmpA/MotB famil...    30   1.0  
UniRef50_Q9UPT8 Cluster: Zinc finger CCCH domain-containing prot...    30   1.3  
UniRef50_Q4RER3 Cluster: Chromosome 13 SCAF15122, whole genome s...    28   1.6  
UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli...    29   2.1  
UniRef50_Q01B13 Cluster: Chromosome 04 contig 1, DNA sequence; n...    29   2.5  
UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh...    28   2.7  
UniRef50_Q0DB93 Cluster: Os06g0590100 protein; n=11; Oryza sativ...    30   2.7  
UniRef50_UPI0000DA25BF Cluster: PREDICTED: hypothetical protein;...    28   3.0  
UniRef50_Q2G984 Cluster: Putative uncharacterized protein precur...    27   3.1  
UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA...    27   3.6  
UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian...    27   3.6  
UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=...    29   3.6  
UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1; ...    28   3.7  
UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2...    27   3.7  
UniRef50_Q7TLL9 Cluster: Capsid associated protein; n=1; Chorist...    29   3.8  
UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe...    25   3.8  
UniRef50_Q2R2Z8 Cluster: Expressed protein; n=2; Oryza sativa|Re...    28   3.8  
UniRef50_Q61345 Cluster: Forkhead box protein D1; n=5; Amniota|R...    29   3.9  
UniRef50_A2XPA8 Cluster: Putative uncharacterized protein; n=3; ...    28   4.0  
UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza s...    29   4.7  
UniRef50_Q70E73 Cluster: Ras-associated and pleckstrin homology ...    27   4.7  
UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve...    27   4.7  
UniRef50_Q6C8P1 Cluster: Similarity; n=1; Yarrowia lipolytica|Re...    27   4.9  
UniRef50_Q1E194 Cluster: Putative uncharacterized protein; n=1; ...    27   4.9  
UniRef50_Q15637 Cluster: Splicing factor 1; n=57; Euteleostomi|R...    27   4.9  
UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ...    29   4.9  
UniRef50_Q01J64 Cluster: H0418A01.4 protein; n=4; Oryza sativa|R...    27   4.9  
UniRef50_Q4V722 Cluster: IP08802p; n=3; Sophophora|Rep: IP08802p...    31   5.0  
UniRef50_Q710T9 Cluster: 60I2G03 protein; n=1; Populus deltoides...    27   5.1  
UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057...    29   5.2  
UniRef50_UPI0000DD7C02 Cluster: PREDICTED: hypothetical protein;...    27   5.2  
UniRef50_A0DMD8 Cluster: Chromosome undetermined scaffold_56, wh...    31   5.9  
UniRef50_Q8NFF8 Cluster: MLL5; n=52; Euteleostomi|Rep: MLL5 - Ho...    29   5.9  
UniRef50_A0MLV7 Cluster: IDC1 protein; n=1; Podospora anserina|R...    27   6.0  
UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ...    27   6.0  
UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy...    27   6.0  
UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2...    27   6.1  
UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w...    27   6.1  
UniRef50_UPI00015B4B18 Cluster: PREDICTED: similar to ENSANGP000...    27   6.1  
UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro...    27   6.1  
UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; D...    27   6.1  
UniRef50_UPI00015B4FEB Cluster: PREDICTED: similar to conserved ...    27   6.2  
UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FN...    27   6.3  
UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re...    27   6.3  
UniRef50_UPI0000F2D09F Cluster: PREDICTED: hypothetical protein;...    28   6.3  
UniRef50_Q0RX02 Cluster: Putative uncharacterized protein; n=4; ...    27   6.3  
UniRef50_UPI0000F1E915 Cluster: PREDICTED: hypothetical protein;...    27   6.4  
UniRef50_A6G9W3 Cluster: Putative uncharacterized protein; n=1; ...    27   6.4  
UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ...    27   6.4  
UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop...    27   6.4  
UniRef50_A2F7Y5 Cluster: Putative uncharacterized protein; n=1; ...    27   6.5  
UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1; ...    27   6.5  
UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gamb...    27   6.6  
UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014...    27   7.7  
UniRef50_Q5SJG1 Cluster: Putative uncharacterized protein TTHA10...    27   7.8  
UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropica...    29   7.9  
UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous...    27   7.9  
UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|...    27   8.0  
UniRef50_Q0USP6 Cluster: Predicted protein; n=1; Phaeosphaeria n...    27   8.0  
UniRef50_Q1E852 Cluster: Putative uncharacterized protein; n=1; ...    28   8.1  
UniRef50_Q383M3 Cluster: Putative uncharacterized protein; n=3; ...    27   8.2  
UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda...    29   8.3  
UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s...    27   8.3  
UniRef50_Q0D806 Cluster: Os07g0192900 protein; n=5; Magnoliophyt...    27   8.4  
UniRef50_UPI00015553D6 Cluster: PREDICTED: hypothetical protein;...    27   8.5  
UniRef50_UPI0000DA1F1A Cluster: PREDICTED: hypothetical protein;...    28   8.5  
UniRef50_A6NLS7 Cluster: Uncharacterized protein ENSP00000341748...    28   8.6  
UniRef50_P48023 Cluster: Tumor necrosis factor ligand superfamil...    27   8.8  
UniRef50_Q6Z9Z2 Cluster: Putative uncharacterized protein P0437G...    27   9.2  
UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve...    30   9.9  

>UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium
            discoideum|Rep: Actin-binding protein - Dictyostelium
            discoideum AX4
          Length = 1126

 Score = 29.5 bits (63), Expect(2) = 4.7
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 562  PPPPPPPPP 570



 Score = 27.9 bits (59), Expect(3) = 0.014
 Identities = 11/27 (40%), Positives = 11/27 (40%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPP 1301
            PP            GG    PPPPPPP
Sbjct: 545  PPPPPPPPPAPPVSGGGPPPPPPPPPP 571



 Score = 26.6 bits (56), Expect(3) = 0.014
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 577  PPPPPPPP 584



 Score = 26.6 bits (56), Expect(3) = 0.014
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 589  PPPPPPPP 596



 Score = 24.2 bits (50), Expect(2) = 4.7
 Identities = 8/14 (57%), Positives = 8/14 (57%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPP PP
Sbjct: 543  GAPPPPPPPPPAPP 556


>UniRef50_Q4RQM1 Cluster: Chromosome 2 SCAF15004, whole genome shotgun
            sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 2
            SCAF15004, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1278

 Score = 29.9 bits (64), Expect(2) = 0.12
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            GG    PPPPPPPP
Sbjct: 643  GGMPAPPPPPPPPP 656



 Score = 29.5 bits (63), Expect(2) = 0.12
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 680  PPPPPPPPP 688


>UniRef50_Q54ER5 Cluster: Formin homology domain-containing protein;
            n=1; Dictyostelium discoideum AX4|Rep: Formin homology
            domain-containing protein - Dictyostelium discoideum AX4
          Length = 2546

 Score = 29.5 bits (63), Expect(2) = 0.55
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 1076 PPPPPPPPP 1084



 Score = 27.5 bits (58), Expect(2) = 0.55
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 1056 GGPPPPPPPPPPP 1068


>UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio
            rerio|Rep: Putative uncharacterized protein - Danio rerio
            (Zebrafish) (Brachydanio rerio)
          Length = 428

 Score = 27.5 bits (58), Expect(2) = 3.9
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 343  GNMGVPPPPPPPPP 356



 Score = 27.5 bits (58), Expect(2) = 3.9
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 357  GNMGVPPPPPPPPP 370



 Score = 26.6 bits (56), Expect(3) = 0.56
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 321  PPPPPPPP 328



 Score = 26.6 bits (56), Expect(2) = 3.9
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 376  PPPPPPPP 383



 Score = 26.6 bits (56), Expect(2) = 3.9
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 405  PPPPPPPP 412



 Score = 25.0 bits (52), Expect(3) = 0.56
 Identities = 10/26 (38%), Positives = 10/26 (38%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPP 1298
            PP            GG    PPPPPP
Sbjct: 275  PPPPPSPPPPGSVYGGSLVPPPPPPP 300



 Score = 23.8 bits (49), Expect(3) = 0.56
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 1281 PPPPPPP 1301
            PPPPPPP
Sbjct: 309  PPPPPPP 315


>UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces
            cerevisiae YNL271c BNI1 regulator of budding; n=1;
            Yarrowia lipolytica|Rep: Similar to sp|P41832
            Saccharomyces cerevisiae YNL271c BNI1 regulator of
            budding - Yarrowia lipolytica (Candida lipolytica)
          Length = 1851

 Score = 29.5 bits (63), Expect(2) = 0.56
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 1067 PPPPPPPPP 1075



 Score = 29.5 bits (63), Expect(2) = 0.72
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 1068 PPPPPPPPP 1076



 Score = 27.5 bits (58), Expect(2) = 0.56
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 1041 GGPPPPPPPPPPP 1053



 Score = 27.1 bits (57), Expect(2) = 0.72
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPP 1301
            GG    PPPPPPP
Sbjct: 1041 GGPPPPPPPPPPP 1053


>UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo
            sapiens (Human)
          Length = 1419

 Score = 29.5 bits (63), Expect(2) = 0.57
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 921  PPPPPPPPP 929



 Score = 27.5 bits (58), Expect(2) = 0.57
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 900  GPPLPPPPPPPPP 912


>UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2;
            Dictyostelium discoideum|Rep: Formin homology protein A -
            Dictyostelium discoideum (Slime mold)
          Length = 1218

 Score = 29.5 bits (63), Expect(2) = 0.57
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 678  PPPPPPPPP 686



 Score = 29.5 bits (63), Expect(2) = 0.74
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 692  PPPPPPPPP 700



 Score = 27.5 bits (58), Expect(2) = 0.57
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 659  GGGAPPPPPPPPP 671



 Score = 27.1 bits (57), Expect(2) = 0.74
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPP 1301
            GG    PPPPPPP
Sbjct: 674  GGGGPPPPPPPPP 686


>UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_53, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1117

 Score = 29.5 bits (63), Expect(2) = 0.57
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 622  PPPPPPPPP 630



 Score = 29.5 bits (63), Expect(2) = 8.0
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 623  PPPPPPPPP 631



 Score = 27.5 bits (58), Expect(2) = 0.57
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 601  GQKTGPPPPPPPP 613



 Score = 23.4 bits (48), Expect(2) = 8.0
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPP P
Sbjct: 588  GQKAGPPPPPPLP 600


>UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1;
            Trypanosoma brucei|Rep: Putative uncharacterized protein
            - Trypanosoma brucei
          Length = 576

 Score = 29.5 bits (63), Expect(2) = 0.60
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 550  PPPPPPPPP 558



 Score = 27.5 bits (58), Expect(2) = 0.60
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 523  GGVPPPPPPPPPP 535


>UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun
            sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3
            SCAF14700, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1204

 Score = 29.9 bits (64), Expect(2) = 0.74
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            GG    PPPPPPPP
Sbjct: 605  GGVPPPPPPPPPPP 618



 Score = 27.5 bits (58), Expect(2) = 3.6
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 621  GAMGAPPPPPPPPP 634



 Score = 26.6 bits (56), Expect(2) = 0.74
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 652  PPPPPPPP 659



 Score = 26.6 bits (56), Expect(2) = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 665  PPPPPPPP 672


>UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human
            herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 -
            Epstein-Barr virus (strain B95-8) (HHV-4) (Human
            herpesvirus 4)
          Length = 487

 Score = 28.3 bits (60), Expect(2) = 0.78
 Identities = 10/18 (55%), Positives = 10/18 (55%)
 Frame = +2

Query: 1253 GXXGGAXXXXPPPPPPPP 1306
            G   G     PPPPPPPP
Sbjct: 53   GENTGVPPPLPPPPPPPP 70



 Score = 28.3 bits (60), Expect(2) = 0.78
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPPP R
Sbjct: 93   PPPPPPPPQR 102


>UniRef50_Q9UQL5 Cluster: DEAD-box protein p72; n=15;
            Euteleostomi|Rep: DEAD-box protein p72 - Homo sapiens
            (Human)
          Length = 183

 Score = 28.3 bits (60), Expect(2) = 0.85
 Identities = 10/18 (55%), Positives = 10/18 (55%)
 Frame = +2

Query: 1253 GXXGGAXXXXPPPPPPPP 1306
            G  G      PPPPPPPP
Sbjct: 162  GYMGQTAYQYPPPPPPPP 179



 Score = 28.3 bits (60), Expect(2) = 0.85
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPPP R
Sbjct: 173  PPPPPPPPSR 182


>UniRef50_A3LZQ9 Cluster: Predicted protein; n=1; Pichia stipitis|Rep:
            Predicted protein - Pichia stipitis (Yeast)
          Length = 1786

 Score = 30.7 bits (66), Expect(2) = 0.95
 Identities = 12/28 (42%), Positives = 12/28 (42%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            PP            GG    PPPPPPPP
Sbjct: 1074 PPLPEFMRTVKTDIGGPPPPPPPPPPPP 1101



 Score = 25.4 bits (53), Expect(2) = 0.95
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 1095 PPPPPPPLP 1103


>UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=2;
            Ostreococcus|Rep: RhoA GTPase effector DIA/Diaphanous -
            Ostreococcus tauri
          Length = 1105

 Score = 28.3 bits (60), Expect(2) = 0.97
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPPP R
Sbjct: 477  PPPPPPPPPR 486



 Score = 27.9 bits (59), Expect(2) = 0.97
 Identities = 11/29 (37%), Positives = 11/29 (37%)
 Frame = +2

Query: 1220 PPXXXXXXXXXGXXGGAXXXXPPPPPPPP 1306
            PP              A    PPPPPPPP
Sbjct: 448  PPPPPPPPFARAQSANANVSAPPPPPPPP 476


>UniRef50_Q2IG02 Cluster: Outer membrane protein, OmpA/MotB family
            precursor; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep:
            Outer membrane protein, OmpA/MotB family precursor -
            Anaeromyxobacter dehalogenans (strain 2CP-C)
          Length = 542

 Score = 29.9 bits (64), Expect(2) = 1.0
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            GG    PPPPPPPP
Sbjct: 303  GGKKAAPPPPPPPP 316



 Score = 26.2 bits (55), Expect(2) = 1.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 310  PPPPPPPDP 318


>UniRef50_Q9UPT8 Cluster: Zinc finger CCCH domain-containing protein
            C19orf7; n=20; Theria|Rep: Zinc finger CCCH
            domain-containing protein C19orf7 - Homo sapiens (Human)
          Length = 1303

 Score = 29.9 bits (64), Expect(2) = 1.3
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            GG    PPPPPPPP
Sbjct: 539  GGPPPPPPPPPPPP 552



 Score = 25.8 bits (54), Expect(2) = 1.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 546  PPPPPPPGP 554


>UniRef50_Q4RER3 Cluster: Chromosome 13 SCAF15122, whole genome
            shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 13
            SCAF15122, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1175

 Score = 28.3 bits (60), Expect(2) = 1.6
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPPP R
Sbjct: 503  PPPPPPPPSR 512



 Score = 27.1 bits (57), Expect(2) = 1.6
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +2

Query: 1265 GAXXXXPPPPPPPP 1306
            G     PPPPPPPP
Sbjct: 495  GPPPPLPPPPPPPP 508


>UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium
            discoideum|Rep: Actin-binding protein - Dictyostelium
            discoideum AX4
          Length = 1074

 Score = 29.5 bits (63), Expect(2) = 2.1
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 601  PPPPPPPPP 609



 Score = 25.4 bits (53), Expect(2) = 2.1
 Identities = 10/27 (37%), Positives = 10/27 (37%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPP 1301
            PP            G     PPPPPPP
Sbjct: 569  PPPSPSPPPPISGGGAPPPPPPPPPPP 595


>UniRef50_Q01B13 Cluster: Chromosome 04 contig 1, DNA sequence; n=1;
            Ostreococcus tauri|Rep: Chromosome 04 contig 1, DNA
            sequence - Ostreococcus tauri
          Length = 154

 Score = 29.5 bits (63), Expect(2) = 2.5
 Identities = 12/29 (41%), Positives = 12/29 (41%)
 Frame = +2

Query: 1220 PPXXXXXXXXXGXXGGAXXXXPPPPPPPP 1306
            PP         G   G     PPPPPPPP
Sbjct: 94   PPYYYAETSYGGDAYGRRPSYPPPPPPPP 122



 Score = 25.4 bits (53), Expect(2) = 2.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 1286 PPPPPPPXR 1312
            PPPPPPP R
Sbjct: 115  PPPPPPPPR 123


>UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun
            sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978,
            whole genome shotgun sequence - Tetraodon nigroviridis
            (Green puffer)
          Length = 1449

 Score = 28.3 bits (60), Expect(2) = 2.7
 Identities = 11/28 (39%), Positives = 11/28 (39%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            PP            G     PPPPPPPP
Sbjct: 876  PPPPTSAHALQVNGGSFPPPPPPPPPPP 903



 Score = 26.2 bits (55), Expect(2) = 2.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 897  PPPPPPPAP 905


>UniRef50_Q0DB93 Cluster: Os06g0590100 protein; n=11; Oryza
            sativa|Rep: Os06g0590100 protein - Oryza sativa subsp.
            japonica (Rice)
          Length = 1399

 Score = 29.9 bits (64), Expect(2) = 2.7
 Identities = 10/15 (66%), Positives = 10/15 (66%)
 Frame = +2

Query: 1262 GGAXXXXPPPPPPPP 1306
            GG     PPPPPPPP
Sbjct: 73   GGGLLKSPPPPPPPP 87



 Score = 24.6 bits (51), Expect(2) = 2.7
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPP  R
Sbjct: 92   PPPPPPPHAR 101


>UniRef50_UPI0000DA25BF Cluster: PREDICTED: hypothetical protein; n=2;
            Rattus norvegicus|Rep: PREDICTED: hypothetical protein -
            Rattus norvegicus
          Length = 310

 Score = 28.3 bits (60), Expect(2) = 3.0
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPPP R
Sbjct: 191  PPPPPPPPPR 200



 Score = 26.2 bits (55), Expect(2) = 3.0
 Identities = 10/18 (55%), Positives = 10/18 (55%)
 Frame = +2

Query: 1253 GXXGGAXXXXPPPPPPPP 1306
            G  G A     PPPPPPP
Sbjct: 180  GGRGPAHYAKRPPPPPPP 197


>UniRef50_Q2G984 Cluster: Putative uncharacterized protein precursor;
            n=1; Novosphingobium aromaticivorans DSM 12444|Rep:
            Putative uncharacterized protein precursor -
            Novosphingobium aromaticivorans (strain DSM 12444)
          Length = 243

 Score = 27.5 bits (58), Expect(2) = 3.1
 Identities = 10/15 (66%), Positives = 10/15 (66%)
 Frame = +2

Query: 1262 GGAXXXXPPPPPPPP 1306
            G A    PPPPPPPP
Sbjct: 20   GLASCAAPPPPPPPP 34



 Score = 27.1 bits (57), Expect(2) = 3.1
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPPP +
Sbjct: 31   PPPPPPPPPK 40


>UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA;
            n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
            similar to CG33556-PA - Strongylocentrotus purpuratus
          Length = 1472

 Score = 27.5 bits (58), Expect(2) = 3.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 434  GAPPPPPPPPPPP 446



 Score = 26.6 bits (56), Expect(2) = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 466  PPPPPPPP 473


>UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis
            thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana
            (Mouse-ear cress)
          Length = 1289

 Score = 27.5 bits (58), Expect(2) = 3.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 978  GYGSPPPPPPPPP 990



 Score = 26.6 bits (56), Expect(2) = 3.6
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 1010 PPPPPPPP 1017



 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 1023 PPPPPPPP 1030



 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 1049 PPPPPPPP 1056


>UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2;
            Mus musculus|Rep: FH1/FH2 domain-containing protein 1 -
            Mus musculus (Mouse)
          Length = 1197

 Score = 29.5 bits (63), Expect(2) = 3.6
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 618  PPPPPPPPP 626



 Score = 29.5 bits (63), Expect(2) = 7.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 619  PPPPPPPPP 627



 Score = 24.6 bits (51), Expect(2) = 3.6
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 1266 GXXXXPPPPPPP 1301
            G    PPPPPPP
Sbjct: 585  GGPPPPPPPPPP 596



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 8/14 (57%), Positives = 8/14 (57%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPP PPP
Sbjct: 599  GSCPPPPPPPLPPP 612


>UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1;
            Methylobacterium sp. 4-46|Rep: Putative uncharacterized
            protein - Methylobacterium sp. 4-46
          Length = 980

 Score = 27.9 bits (59), Expect(2) = 3.7
 Identities = 12/33 (36%), Positives = 12/33 (36%)
 Frame = +3

Query: 1206 GVXXXPPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            G    PP            GG    PPPPP PP
Sbjct: 704  GSGVAPPPQVAAPVGNVAQGGVTPPPPPPPAPP 736



 Score = 26.2 bits (55), Expect(2) = 3.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PP PPPPPP
Sbjct: 747  PPAPPPPPP 755


>UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21;
            n=1; Arabidopsis thaliana|Rep: Putative uncharacterized
            protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 907

 Score = 27.5 bits (58), Expect(2) = 3.7
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 544  GTAAAPPPPPPPP 556



 Score = 27.5 bits (58), Expect(2) = 6.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 557  GTQAAPPPPPPPP 569



 Score = 26.6 bits (56), Expect(2) = 6.2
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 508  PPPPPPPP 515



 Score = 26.6 bits (56), Expect(2) = 6.2
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 523  PPPPPPPP 530



 Score = 26.6 bits (56), Expect(2) = 6.2
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 536  PPPPPPPP 543



 Score = 26.6 bits (56), Expect(2) = 6.2
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 549  PPPPPPPP 556



 Score = 26.6 bits (56), Expect(2) = 3.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 562  PPPPPPPP 569



 Score = 25.8 bits (54), Expect(2) = 6.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 590  PPPPPPPMP 598


>UniRef50_Q7TLL9 Cluster: Capsid associated protein; n=1;
            Choristoneura fumiferana MNPV|Rep: Capsid associated
            protein - Choristoneura fumiferana nuclear polyhedrosis
            virus (CfMNPV)
          Length = 631

 Score = 29.5 bits (63), Expect(2) = 3.8
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 350  PPPPPPPPP 358



 Score = 24.6 bits (51), Expect(2) = 3.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 1266 GXXXXPPPPPPP 1301
            G    PPPPPPP
Sbjct: 321  GIPPPPPPPPPP 332


>UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba
            histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba
            histolytica HM-1:IMSS
          Length = 1176

 Score = 24.6 bits (51), Expect(3) = 3.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 1266 GXXXXPPPPPPP 1301
            G    PPPPPPP
Sbjct: 612  GASSIPPPPPPP 623



 Score = 23.8 bits (49), Expect(3) = 6.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 1281 PPPPPPP 1301
            PPPPPPP
Sbjct: 605  PPPPPPP 611



 Score = 23.8 bits (49), Expect(3) = 6.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 1284 PPPPPPP 1304
            PPPPPPP
Sbjct: 617  PPPPPPP 623



 Score = 23.8 bits (49), Expect(3) = 3.8
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 1284 PPPPPPP 1304
            PPPPPPP
Sbjct: 629  PPPPPPP 635



 Score = 23.8 bits (49), Expect(3) = 6.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 1287 PPPPPPP 1307
            PPPPPPP
Sbjct: 629  PPPPPPP 635



 Score = 23.8 bits (49), Expect(3) = 3.8
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +3

Query: 1287 PPPPPPP 1307
            PPPPPPP
Sbjct: 641  PPPPPPP 647


>UniRef50_Q2R2Z8 Cluster: Expressed protein; n=2; Oryza sativa|Rep:
            Expressed protein - Oryza sativa subsp. japonica (Rice)
          Length = 489

 Score = 28.3 bits (60), Expect(2) = 3.8
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPPP R
Sbjct: 89   PPPPPPPPPR 98



 Score = 25.8 bits (54), Expect(2) = 3.8
 Identities = 9/15 (60%), Positives = 9/15 (60%)
 Frame = +2

Query: 1262 GGAXXXXPPPPPPPP 1306
            G A    PPP PPPP
Sbjct: 76   GAAPDQEPPPSPPPP 90


>UniRef50_Q61345 Cluster: Forkhead box protein D1; n=5; Amniota|Rep:
            Forkhead box protein D1 - Mus musculus (Mouse)
          Length = 456

 Score = 29.5 bits (63), Expect(2) = 3.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 308  PPPPPPPPP 316



 Score = 24.6 bits (51), Expect(2) = 3.9
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 1266 GXXXXPPPPPPP 1301
            G    PPPPPPP
Sbjct: 256  GAALFPPPPPPP 267


>UniRef50_A2XPA8 Cluster: Putative uncharacterized protein; n=3; Oryza
            sativa|Rep: Putative uncharacterized protein - Oryza
            sativa subsp. indica (Rice)
          Length = 255

 Score = 28.3 bits (60), Expect(2) = 4.0
 Identities = 11/28 (39%), Positives = 11/28 (39%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            PP            G     PPPPPPPP
Sbjct: 3    PPPPCCVLVVRCCSGSLPSPPPPPPPPP 30



 Score = 25.8 bits (54), Expect(2) = 4.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 24   PPPPPPPRP 32


>UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza
            sativa|Rep: Diaphanous homologue-like - Oryza sativa
            subsp. japonica (Rice)
          Length = 1391

 Score = 29.5 bits (63), Expect(2) = 4.7
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 804  PPPPPPPPP 812



 Score = 24.2 bits (50), Expect(2) = 4.7
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    P PPPPPP
Sbjct: 781  GMKTPPTPPPPPP 793


>UniRef50_Q70E73 Cluster: Ras-associated and pleckstrin homology
            domains-containing protein 1; n=21; Amniota|Rep:
            Ras-associated and pleckstrin homology domains-containing
            protein 1 - Homo sapiens (Human)
          Length = 1302

 Score = 27.5 bits (58), Expect(2) = 4.7
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 759  GVVPPPPPPPPPP 771



 Score = 26.2 bits (55), Expect(2) = 4.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 765  PPPPPPPTP 773


>UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1027

 Score = 27.1 bits (57), Expect(2) = 4.7
 Identities = 11/28 (39%), Positives = 11/28 (39%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            PP            G     PPPPPPPP
Sbjct: 422  PPGGVPPPPPPPPPGMGGAPPPPPPPPP 449



 Score = 26.6 bits (56), Expect(2) = 4.7
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 469  PPPPPPPP 476


>UniRef50_Q6C8P1 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep:
            Similarity - Yarrowia lipolytica (Candida lipolytica)
          Length = 649

 Score = 27.5 bits (58), Expect(2) = 4.9
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 557  GMDPNPPPPPPPP 569



 Score = 26.2 bits (55), Expect(2) = 4.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPP PP
Sbjct: 564  PPPPPPKPP 572


>UniRef50_Q1E194 Cluster: Putative uncharacterized protein; n=1;
            Coccidioides immitis|Rep: Putative uncharacterized
            protein - Coccidioides immitis
          Length = 644

 Score = 27.5 bits (58), Expect(2) = 4.9
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 235  GAAAAPPPPPPPPP 248



 Score = 26.2 bits (55), Expect(2) = 4.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPP PP
Sbjct: 243  PPPPPPAPP 251


>UniRef50_Q15637 Cluster: Splicing factor 1; n=57; Euteleostomi|Rep:
            Splicing factor 1 - Homo sapiens (Human)
          Length = 639

 Score = 27.5 bits (58), Expect(2) = 4.9
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 594  GMMYAPPPPPPPP 606



 Score = 26.2 bits (55), Expect(2) = 4.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PP PPPPPP
Sbjct: 629  PPAPPPPPP 637


>UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2;
            Trypanosoma cruzi|Rep: Putative uncharacterized protein -
            Trypanosoma cruzi
          Length = 603

 Score = 29.5 bits (63), Expect(2) = 4.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 422  PPPPPPPPP 430



 Score = 24.2 bits (50), Expect(2) = 4.9
 Identities = 10/28 (35%), Positives = 10/28 (35%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            PP             G    PP PPPPP
Sbjct: 387  PPPPPPPPPPPPPPAGKAPPPPIPPPPP 414


>UniRef50_Q01J64 Cluster: H0418A01.4 protein; n=4; Oryza sativa|Rep:
            H0418A01.4 protein - Oryza sativa (Rice)
          Length = 585

 Score = 27.5 bits (58), Expect(2) = 4.9
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 420  GPPPPPPPPPPPP 432



 Score = 26.2 bits (55), Expect(2) = 4.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 426  PPPPPPPAP 434


>UniRef50_Q4V722 Cluster: IP08802p; n=3; Sophophora|Rep: IP08802p -
            Drosophila melanogaster (Fruit fly)
          Length = 543

 Score = 31.1 bits (67), Expect(2) = 5.0
 Identities = 12/18 (66%), Positives = 12/18 (66%)
 Frame = -2

Query: 1305 GGGGGGGGXXXXAPPXXP 1252
            GGGGGGGG    APP  P
Sbjct: 175  GGGGGGGGGPPNAPPLTP 192



 Score = 22.6 bits (46), Expect(2) = 5.0
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -2

Query: 1311 RXGGGGGGGG 1282
            R GG GGGGG
Sbjct: 164  REGGAGGGGG 173


>UniRef50_Q710T9 Cluster: 60I2G03 protein; n=1; Populus deltoides|Rep:
            60I2G03 protein - Populus deltoides (Eastern poplar)
            (Eastern cottonwood)
          Length = 408

 Score = 27.5 bits (58), Expect(2) = 5.1
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 390  GNNQPPPPPPPPPP 403



 Score = 26.2 bits (55), Expect(2) = 5.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 397  PPPPPPPAP 405


>UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG05727;
            n=1; Caenorhabditis briggsae|Rep: Putative
            uncharacterized protein CBG05727 - Caenorhabditis
            briggsae
          Length = 288

 Score = 29.5 bits (63), Expect(2) = 5.2
 Identities = 10/15 (66%), Positives = 10/15 (66%)
 Frame = +2

Query: 1262 GGAXXXXPPPPPPPP 1306
            GG     PPPPPPPP
Sbjct: 24   GGPVSKRPPPPPPPP 38



 Score = 24.2 bits (50), Expect(2) = 5.2
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 1286 PPPPPPPXR 1312
            PPPPPPP +
Sbjct: 31   PPPPPPPPK 39


>UniRef50_UPI0000DD7C02 Cluster: PREDICTED: hypothetical protein; n=3;
            Catarrhini|Rep: PREDICTED: hypothetical protein - Homo
            sapiens
          Length = 262

 Score = 27.5 bits (58), Expect(2) = 5.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 28   GTTYPPPPPPPPP 40



 Score = 26.2 bits (55), Expect(2) = 5.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 34   PPPPPPPTP 42


>UniRef50_A0DMD8 Cluster: Chromosome undetermined scaffold_56, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_56, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2211

 Score = 30.7 bits (66), Expect(2) = 5.9
 Identities = 12/28 (42%), Positives = 12/28 (42%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            PP            GG    PPPPPPPP
Sbjct: 1381 PPHLYPTSSTGFRFGGLMPPPPPPPPPP 1408



 Score = 22.6 bits (46), Expect(2) = 5.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPP  P
Sbjct: 1413 PPPPPPSNP 1421


>UniRef50_Q8NFF8 Cluster: MLL5; n=52; Euteleostomi|Rep: MLL5 - Homo
            sapiens (Human)
          Length = 1858

 Score = 29.5 bits (63), Expect(2) = 5.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 1715 PPPPPPPPP 1723



 Score = 23.8 bits (49), Expect(2) = 5.9
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPP P
Sbjct: 1674 GHHLPPPPPPPGP 1686


>UniRef50_A0MLV7 Cluster: IDC1 protein; n=1; Podospora anserina|Rep:
            IDC1 protein - Podospora anserina
          Length = 1759

 Score = 27.5 bits (58), Expect(2) = 6.0
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 1557 GNNNLIPPPPPPPP 1570



 Score = 25.8 bits (54), Expect(2) = 6.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPP PP
Sbjct: 1565 PPPPPPVPP 1573


>UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1;
            Coccidioides immitis|Rep: Putative uncharacterized
            protein - Coccidioides immitis
          Length = 1705

 Score = 27.5 bits (58), Expect(2) = 6.0
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 1004 GFSGGPPPPPPPP 1016



 Score = 26.6 bits (56), Expect(2) = 6.0
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 980  PPPPPPPP 987



 Score = 26.6 bits (56), Expect(2) = 6.0
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 994  PPPPPPPP 1001



 Score = 25.8 bits (54), Expect(2) = 6.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 1025 PPPPPPPMP 1033


>UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces
            capsulatus NAm1|Rep: Cytokinesis protein sepA -
            Ajellomyces capsulatus NAm1
          Length = 1670

 Score = 26.6 bits (56), Expect(2) = 6.0
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 966  PPPPPPPP 973



 Score = 26.6 bits (56), Expect(2) = 6.0
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 978  PPPPPPPP 985


>UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin
            1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED:
            similar to formin 1,2/cappuccino - Nasonia vitripennis
          Length = 1271

 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 556  PPPPPPPP 563



 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 597  PPPPPPPP 604


>UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_104, whole genome
            shotgun sequence - Paramecium tetraurelia
          Length = 1152

 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 642  PPPPPPPP 649



 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 658  PPPPPPPP 665


>UniRef50_UPI00015B4B18 Cluster: PREDICTED: similar to
            ENSANGP00000016905; n=1; Nasonia vitripennis|Rep:
            PREDICTED: similar to ENSANGP00000016905 - Nasonia
            vitripennis
          Length = 1147

 Score = 27.5 bits (58), Expect(2) = 6.1
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 194  GYPPPPPPPPPPP 206



 Score = 25.8 bits (54), Expect(2) = 6.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 200  PPPPPPPNP 208


>UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein;
            n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2
            Domain containing protein - Trichomonas vaginalis G3
          Length = 1139

 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 537  PPPPPPPP 544



 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 548  PPPPPPPP 555



 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 548  PPPPPPPP 555



 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 561  PPPPPPPP 568


>UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2;
            Dictyostelium discoideum|Rep: Diaphanous-related formin
            dDia2 - Dictyostelium discoideum (Slime mold)
          Length = 1087

 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 594  PPPPPPPP 601



 Score = 26.6 bits (56), Expect(2) = 6.1
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 608  PPPPPPPP 615


>UniRef50_UPI00015B4FEB Cluster: PREDICTED: similar to conserved
            hypothetical protein; n=1; Nasonia vitripennis|Rep:
            PREDICTED: similar to conserved hypothetical protein -
            Nasonia vitripennis
          Length = 1005

 Score = 27.5 bits (58), Expect(2) = 6.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 835  GVDVRPPPPPPPP 847



 Score = 25.8 bits (54), Expect(2) = 6.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 841  PPPPPPPMP 849


>UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FNBP4
            protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 769

 Score = 26.6 bits (56), Expect(2) = 6.3
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 616  PPPPPPPP 623



 Score = 26.6 bits (56), Expect(2) = 6.3
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 626  PPPPPPPP 633


>UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep:
            Os07g0596300 protein - Oryza sativa subsp. japonica
            (Rice)
          Length = 754

 Score = 26.6 bits (56), Expect(2) = 6.3
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 156  PPPPPPPP 163



 Score = 26.6 bits (56), Expect(2) = 6.3
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 179  PPPPPPPP 186


>UniRef50_UPI0000F2D09F Cluster: PREDICTED: hypothetical protein; n=1;
            Monodelphis domestica|Rep: PREDICTED: hypothetical
            protein - Monodelphis domestica
          Length = 91

 Score = 28.3 bits (60), Expect(2) = 6.3
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPPP R
Sbjct: 63   PPPPPPPPAR 72



 Score = 25.4 bits (53), Expect(2) = 6.3
 Identities = 9/15 (60%), Positives = 9/15 (60%)
 Frame = +2

Query: 1262 GGAXXXXPPPPPPPP 1306
            G A    PP PPPPP
Sbjct: 46   GAAEPPAPPRPPPPP 60


>UniRef50_Q0RX02 Cluster: Putative uncharacterized protein; n=4;
            Rhodococcus|Rep: Putative uncharacterized protein -
            Rhodococcus sp. (strain RHA1)
          Length = 688

 Score = 27.5 bits (58), Expect(2) = 6.3
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 653  GLGQSPPPPPPPP 665



 Score = 25.8 bits (54), Expect(2) = 6.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 659  PPPPPPPVP 667


>UniRef50_UPI0000F1E915 Cluster: PREDICTED: hypothetical protein; n=2;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 645

 Score = 27.5 bits (58), Expect(2) = 6.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 573  GCGQAPPPPPPPP 585



 Score = 25.8 bits (54), Expect(2) = 6.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 579  PPPPPPPGP 587


>UniRef50_A6G9W3 Cluster: Putative uncharacterized protein; n=1;
            Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized
            protein - Plesiocystis pacifica SIR-1
          Length = 643

 Score = 27.5 bits (58), Expect(2) = 6.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 366  GTGATPPPPPPPP 378



 Score = 25.8 bits (54), Expect(2) = 6.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 372  PPPPPPPVP 380


>UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1;
            Trichomonas vaginalis G3|Rep: Putative uncharacterized
            protein - Trichomonas vaginalis G3
          Length = 634

 Score = 27.5 bits (58), Expect(2) = 6.4
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 555  GNAPPPPPPPPPPP 568



 Score = 25.8 bits (54), Expect(2) = 6.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 573  PPPPPPPGP 581


>UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin
            - Volvox carteri f. nagariensis
          Length = 606

 Score = 26.6 bits (56), Expect(2) = 6.4
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 253  PPPPPPPP 260



 Score = 26.6 bits (56), Expect(2) = 6.4
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 273  PPPPPPPP 280


>UniRef50_A2F7Y5 Cluster: Putative uncharacterized protein; n=1;
            Trichomonas vaginalis G3|Rep: Putative uncharacterized
            protein - Trichomonas vaginalis G3
          Length = 496

 Score = 27.5 bits (58), Expect(2) = 6.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 101  GQNEAPPPPPPPP 113



 Score = 25.8 bits (54), Expect(2) = 6.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 107  PPPPPPPGP 115


>UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 472

 Score = 26.6 bits (56), Expect(2) = 6.5
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1281 PPPPPPPP 1304
            PPPPPPPP
Sbjct: 327  PPPPPPPP 334



 Score = 26.6 bits (56), Expect(2) = 6.5
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 340  PPPPPPPP 347


>UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gambiae
            str. PEST|Rep: ENSANGP00000000741 - Anopheles gambiae
            str. PEST
          Length = 421

 Score = 27.5 bits (58), Expect(2) = 6.6
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -1

Query: 1303 GGGGGGGGXXXXPP 1262
            GGGGGGGG    PP
Sbjct: 204  GGGGGGGGYGNAPP 217



 Score = 25.8 bits (54), Expect(2) = 6.6
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -1

Query: 1306 GGGGGGGGG 1280
            GGGGGGGGG
Sbjct: 175  GGGGGGGGG 183


>UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1;
            n=2; Sordariomycetes|Rep: Putative uncharacterized
            protein NCU01431.1 - Neurospora crassa
          Length = 1817

 Score = 27.1 bits (57), Expect(2) = 7.7
 Identities = 11/28 (39%), Positives = 11/28 (39%)
 Frame = +3

Query: 1221 PPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            PP            G     PPPPPPPP
Sbjct: 1090 PPPPPPPPPPPPMPGMAGMPPPPPPPPP 1117



 Score = 25.8 bits (54), Expect(2) = 7.7
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 1111 PPPPPPPMP 1119


>UniRef50_Q5SJG1 Cluster: Putative uncharacterized protein TTHA1047;
            n=2; Thermus thermophilus|Rep: Putative uncharacterized
            protein TTHA1047 - Thermus thermophilus (strain HB8 /
            ATCC 27634 / DSM 579)
          Length = 117

 Score = 27.5 bits (58), Expect(2) = 7.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 39   GELEAPPPPPPPP 51



 Score = 25.8 bits (54), Expect(2) = 7.8
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 45   PPPPPPPRP 53


>UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus
            tropicalis|Rep: LOC779576 protein - Xenopus tropicalis
            (Western clawed frog) (Silurana tropicalis)
          Length = 1222

 Score = 29.5 bits (63), Expect(2) = 7.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 1028 PPPPPPPPP 1036



 Score = 27.5 bits (58), Expect(2) = 7.9
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 971  GMPPPPPPPPPPP 983



 Score = 25.4 bits (53), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 1002 PPPPPPPLP 1010



 Score = 23.4 bits (48), Expect(2) = 7.9
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPP P
Sbjct: 998  GNYRPPPPPPPLP 1010


>UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous 1;
            n=1; Monodelphis domestica|Rep: PREDICTED: similar to
            diaphanous 1 - Monodelphis domestica
          Length = 1186

 Score = 27.5 bits (58), Expect(2) = 7.9
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 603  GSISIPPPPPPPPP 616



 Score = 25.4 bits (53), Expect(2) = 7.9
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 610  PPPPPPPLP 618


>UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep:
            Protein diaphanous - Drosophila melanogaster (Fruit fly)
          Length = 1091

 Score = 26.6 bits (56), Expect(2) = 8.0
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 1284 PPPPPPPP 1307
            PPPPPPPP
Sbjct: 554  PPPPPPPP 561



 Score = 26.2 bits (55), Expect(2) = 8.0
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            GG    PPPPPP P
Sbjct: 519  GGGGAPPPPPPPMP 532


>UniRef50_Q0USP6 Cluster: Predicted protein; n=1; Phaeosphaeria
            nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
            (Septoria nodorum)
          Length = 111

 Score = 27.5 bits (58), Expect(2) = 8.0
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            G     PPPPPPPP
Sbjct: 30   GSLQPGPPPPPPPP 43



 Score = 25.8 bits (54), Expect(2) = 8.0
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 37   PPPPPPPHP 45


>UniRef50_Q1E852 Cluster: Putative uncharacterized protein; n=1;
            Coccidioides immitis|Rep: Putative uncharacterized
            protein - Coccidioides immitis
          Length = 933

 Score = 27.9 bits (59), Expect(2) = 8.1
 Identities = 10/18 (55%), Positives = 10/18 (55%)
 Frame = +2

Query: 1253 GXXGGAXXXXPPPPPPPP 1306
            G  G      PPPPPPPP
Sbjct: 110  GFVGPQAVAAPPPPPPPP 127



 Score = 25.0 bits (52), Expect(2) = 8.1
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPP  R
Sbjct: 122  PPPPPPPSLR 131


>UniRef50_Q383M3 Cluster: Putative uncharacterized protein; n=3;
            Trypanosoma|Rep: Putative uncharacterized protein -
            Trypanosoma brucei
          Length = 697

 Score = 27.5 bits (58), Expect(2) = 8.2
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = +2

Query: 1265 GAXXXXPPPPPPPP 1306
            G     PPPPPPPP
Sbjct: 372  GGYHQHPPPPPPPP 385



 Score = 25.4 bits (53), Expect(2) = 8.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 1286 PPPPPPPXR 1312
            PPPPPPP R
Sbjct: 378  PPPPPPPPR 386


>UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep:
            Protein enabled homolog - Homo sapiens (Human)
          Length = 591

 Score = 29.5 bits (63), Expect(2) = 8.3
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPPPP
Sbjct: 347  PPPPPPPPP 355



 Score = 23.4 bits (48), Expect(2) = 8.3
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPP PP
Sbjct: 309  GPLAPPPPPPLPP 321


>UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome
            shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
            SCAF15019, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 579

 Score = 27.5 bits (58), Expect(2) = 8.3
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 357  GAPPPPPPPPPPP 369



 Score = 25.4 bits (53), Expect(2) = 8.3
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 391  PPPPPPPLP 399


>UniRef50_Q0D806 Cluster: Os07g0192900 protein; n=5;
            Magnoliophyta|Rep: Os07g0192900 protein - Oryza sativa
            subsp. japonica (Rice)
          Length = 509

 Score = 27.5 bits (58), Expect(2) = 8.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 150  GPSTLPPPPPPPP 162



 Score = 25.4 bits (53), Expect(2) = 8.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 156  PPPPPPPLP 164


>UniRef50_UPI00015553D6 Cluster: PREDICTED: hypothetical protein; n=4;
            Amniota|Rep: PREDICTED: hypothetical protein -
            Ornithorhynchus anatinus
          Length = 477

 Score = 27.1 bits (57), Expect(2) = 8.5
 Identities = 12/33 (36%), Positives = 12/33 (36%)
 Frame = +3

Query: 1206 GVXXXPPXXXXXXXXXXXXGGXXXXPPPPPPPP 1304
            GV   P             G     PPPPPPPP
Sbjct: 145  GVRQMPSPPKKRAGAGPAPGQSPAPPPPPPPPP 177



 Score = 25.8 bits (54), Expect(2) = 8.5
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 171  PPPPPPPRP 179


>UniRef50_UPI0000DA1F1A Cluster: PREDICTED: hypothetical protein; n=1;
            Rattus norvegicus|Rep: PREDICTED: hypothetical protein -
            Rattus norvegicus
          Length = 432

 Score = 27.9 bits (59), Expect(2) = 8.5
 Identities = 10/18 (55%), Positives = 10/18 (55%)
 Frame = +2

Query: 1253 GXXGGAXXXXPPPPPPPP 1306
            G   G     PPPPPPPP
Sbjct: 288  GGPFGGEAPPPPPPPPPP 305



 Score = 25.0 bits (52), Expect(2) = 8.5
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPP  R
Sbjct: 306  PPPPPPPAPR 315


>UniRef50_A6NLS7 Cluster: Uncharacterized protein ENSP00000341748;
            n=15; Mammalia|Rep: Uncharacterized protein
            ENSP00000341748 - Homo sapiens (Human)
          Length = 405

 Score = 28.3 bits (60), Expect(2) = 8.6
 Identities = 10/18 (55%), Positives = 10/18 (55%)
 Frame = +2

Query: 1253 GXXGGAXXXXPPPPPPPP 1306
            G   G     PPPPPPPP
Sbjct: 279  GQEPGGLALPPPPPPPPP 296



 Score = 24.6 bits (51), Expect(2) = 8.6
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 1283 PPPPPPPPXR 1312
            PPPPPPP  R
Sbjct: 293  PPPPPPPRSR 302


>UniRef50_P48023 Cluster: Tumor necrosis factor ligand superfamily
            member 6 (Fas antigen ligand) (Fas ligand) (CD178
            antigen) (CD95L protein) (Apoptosis antigen ligand)
            (APTL) [Contains: Tumor necrosis factor ligand
            superfamily member 6, membrane form; Tumor necrosis
            factor ligand superfamily member 6, soluble form]; n=33;
            Fungi/Metazoa group|Rep: Tumor necrosis factor ligand
            superfamily member 6 (Fas antigen ligand) (Fas ligand)
            (CD178 antigen) (CD95L protein) (Apoptosis antigen
            ligand) (APTL) [Contains: Tumor necrosis factor ligand
            superfamily member 6, membrane form; Tumor necrosis
            factor ligand superfamily member 6, soluble form] - Homo
            sapiens (Human)
          Length = 281

 Score = 27.5 bits (58), Expect(2) = 8.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 41   GQRRPPPPPPPPP 53



 Score = 25.4 bits (53), Expect(2) = 8.8
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPP PP
Sbjct: 57   PPPPPPLPP 65


>UniRef50_Q6Z9Z2 Cluster: Putative uncharacterized protein
            P0437G01.20; n=2; Oryza sativa (japonica
            cultivar-group)|Rep: Putative uncharacterized protein
            P0437G01.20 - Oryza sativa subsp. japonica (Rice)
          Length = 187

 Score = 27.5 bits (58), Expect(2) = 9.2
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 1266 GXXXXPPPPPPPP 1304
            G    PPPPPPPP
Sbjct: 52   GFRLPPPPPPPPP 64



 Score = 25.4 bits (53), Expect(2) = 9.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 1281 PPPPPPPPP 1307
            PPPPPPP P
Sbjct: 58   PPPPPPPLP 66


>UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 2195

 Score = 29.9 bits (64), Expect(2) = 9.9
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = +3

Query: 1263 GGXXXXPPPPPPPP 1304
            GG    PPPPPPPP
Sbjct: 956  GGAGPPPPPPPPPP 969



 Score = 22.6 bits (46), Expect(2) = 9.9
 Identities = 9/13 (69%), Positives = 9/13 (69%), Gaps = 4/13 (30%)
 Frame = +3

Query: 1281 PPPP----PPPPP 1307
            PPPP    PPPPP
Sbjct: 966  PPPPGLPAPPPPP 978


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 340,071,719
Number of Sequences: 1657284
Number of extensions: 4183896
Number of successful extensions: 215957
Number of sequences better than 10.0: 84
Number of HSP's better than 10.0 without gapping: 23719
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 86870
length of database: 575,637,011
effective HSP length: 103
effective length of database: 404,936,759
effective search space used: 146182169999
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -