BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP14_F_K15.2
(1797 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF026214-3|AAB71312.2| 493|Caenorhabditis elegans Amino acid tr... 29 7.9
>AF026214-3|AAB71312.2| 493|Caenorhabditis elegans Amino acid
transporter protein 3 protein.
Length = 493
Score = 29.5 bits (63), Expect = 7.9
Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
Frame = -3
Query: 1465 TQLXNLMYYLLE--ILNYLHYFQVMFALILG*CILLKLYFFKNIQXA 1331
T L +L+Y LL I + ++Y QV + + +G IL YF K + A
Sbjct: 363 TGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDA 409
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,120,229
Number of Sequences: 27780
Number of extensions: 278839
Number of successful extensions: 378
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 333
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 375
length of database: 12,740,198
effective HSP length: 86
effective length of database: 10,351,118
effective search space used: 5299772416
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -