Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP14_F_H15.2
         (1294 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863...    32   0.86 

>03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,
            8631332-8631397,8631891-8631967,8632659-8633070
          Length = 351

 Score = 32.3 bits (70), Expect = 0.86
 Identities = 15/44 (34%), Positives = 16/44 (36%)
 Frame = -3

Query: 1217 PXXXGXXPPPXXXPPXXXPPXXXXXPPXXGXAXGSVXPGRTGXP 1086
            P   G  PPP   P    PP     PP  G A  +  PG    P
Sbjct: 298  PPVGGTQPPPPPPPLANGPPRSIPPPPMTGGAMANFTPGAPPRP 341


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,079,822
Number of Sequences: 37544
Number of extensions: 259258
Number of successful extensions: 669
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 610
length of database: 14,793,348
effective HSP length: 84
effective length of database: 11,639,652
effective search space used: 4027319592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)