BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP14_F_H14.2
(1606 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
01_01_0095 + 733307-734060,734779-734802,735029-736098 32 1.5
>01_01_0095 + 733307-734060,734779-734802,735029-736098
Length = 615
Score = 31.9 bits (69), Expect = 1.5
Identities = 19/58 (32%), Positives = 28/58 (48%)
Frame = -1
Query: 946 SWIXRAAPEIRFSPRLC*XAFKSAIHSFKCSCSKLSVCFGVPKVLGSNXIXPSKATGV 773
SW + PEIRF P + S+ S SC++L+ C G +L + P K T +
Sbjct: 17 SWCSDSGPEIRF-PHQLESSNSSSSSSCSASCARLA-CSGPDTILHHPFLGPCKVTAI 72
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,610,609
Number of Sequences: 37544
Number of extensions: 306641
Number of successful extensions: 343
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 340
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 343
length of database: 14,793,348
effective HSP length: 85
effective length of database: 11,602,108
effective search space used: 5209346492
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -