Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP14_F_G23.2
         (1136 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U80952-4|AAB38095.1|  662|Caenorhabditis elegans Hypothetical pr...    32   0.86 

>U80952-4|AAB38095.1|  662|Caenorhabditis elegans Hypothetical
           protein F54H5.5 protein.
          Length = 662

 Score = 31.9 bits (69), Expect = 0.86
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 1/71 (1%)
 Frame = +2

Query: 560 EGEPEYVGDRPRIFSPPIRQLNVPTRILRLEFNHKLLPYYTELDAVLLKGLQPPNFVKXX 739
           EGE EY    P +F P      +P R +    + KLL     L+A+  KGL   NF    
Sbjct: 471 EGEIEYPASEPAVFLPNEVSDEIPKRHVAYHIHEKLLA--EMLEAMCEKGLFDGNFTSLP 528

Query: 740 N-NSXTRVCLS 769
           +    + +CLS
Sbjct: 529 SMKPVSYLCLS 539


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,262,701
Number of Sequences: 27780
Number of extensions: 356802
Number of successful extensions: 866
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 834
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 866
length of database: 12,740,198
effective HSP length: 83
effective length of database: 10,434,458
effective search space used: 3078165110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)