SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP14_F_G21.2
         (1266 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_0213 + 26815889-26816475,26817718-26817788,26817985-268180...    35   0.12 

>02_05_0213 +
           26815889-26816475,26817718-26817788,26817985-26818073,
           26818910-26818991,26819089-26819204,26819290-26819451,
           26819531-26819680,26819969-26820037,26820375-26820491
          Length = 480

 Score = 35.1 bits (77), Expect = 0.12
 Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +2

Query: 506 VRRRRPV--PMNKLMEVGPDKFSFPSGHASRAVLISFILIYFDSVSIIFYPPLMAWVVSV 679
           VRR RP     +  + V  D +SFPSGH+SRA L++  L    +        L  W  S 
Sbjct: 105 VRRPRPAYNAADMYVAVAADHWSFPSGHSSRAFLVAAFL----AAGGFPREALFLWAAST 160

Query: 680 SISR 691
           S SR
Sbjct: 161 SASR 164


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,054,818
Number of Sequences: 37544
Number of extensions: 457246
Number of successful extensions: 801
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 780
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 801
length of database: 14,793,348
effective HSP length: 84
effective length of database: 11,639,652
effective search space used: 3922562724
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -