BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP14_F_G21.2
(1266 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U39648-9|AAM15605.1| 186|Caenorhabditis elegans Hypothetical pr... 38 0.011
>U39648-9|AAM15605.1| 186|Caenorhabditis elegans Hypothetical
protein T13C5.6 protein.
Length = 186
Score = 38.3 bits (85), Expect = 0.011
Identities = 21/64 (32%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
Frame = +2
Query: 503 FVRRRRPVPM-NKLMEVGPDKFSFPSGHASRAVLISFILIYFDSVSIIFYPPLMAWVVSV 679
+ R RP+ +KL+E D +SFPSGH+SRA ++ ++ Y + + ++ P + + + V
Sbjct: 85 YFHRERPIKTYSKLLEHTVDIYSFPSGHSSRAAML-LVMAY--NAAPLYVIPFIPFPLVV 141
Query: 680 SISR 691
+SR
Sbjct: 142 GLSR 145
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,783,176
Number of Sequences: 27780
Number of extensions: 411789
Number of successful extensions: 747
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 725
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 747
length of database: 12,740,198
effective HSP length: 83
effective length of database: 10,434,458
effective search space used: 3526846804
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -