BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP13_F_L07
(875 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A0B982 Cluster: Metallophosphoesterase; n=1; Methanosae... 34 4.1
>UniRef50_A0B982 Cluster: Metallophosphoesterase; n=1; Methanosaeta
thermophila PT|Rep: Metallophosphoesterase -
Methanosaeta thermophila (strain DSM 6194 / PT)
(Methanothrixthermophila (strain DSM 6194 / PT))
Length = 375
Score = 34.3 bits (75), Expect = 4.1
Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%)
Frame = +2
Query: 20 HYRESLRFY--SWYKGSKAIFSNFNGLPGRRGNKLINLNSGSV 142
HY + R +WY GS F NFN P R+G +++L++G V
Sbjct: 195 HYHDQRRIAQNTWYSGSIEYF-NFNEAPQRKGALMVDLSTGGV 236
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 737,520,152
Number of Sequences: 1657284
Number of extensions: 14487264
Number of successful extensions: 28302
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 27440
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28300
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 78292544701
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -