Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP13_F_F23
         (884 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C prot...    47   3e-07
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    22   8.6  

>AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C
           protein.
          Length = 149

 Score = 46.8 bits (106), Expect = 3e-07
 Identities = 22/38 (57%), Positives = 29/38 (76%)
 Frame = +1

Query: 757 VLSREKGTGKLYAMKILKKHLIIQKDEVAHTITENRVL 870
           +L+  KGT +LYA+KILKK +IIQ D+V  T+ E RVL
Sbjct: 1   MLAERKGTDELYAIKILKKDIIIQDDDVECTMVEKRVL 38


>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 21.8 bits (44), Expect = 8.6
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +3

Query: 426 PSQQVHRTRLPD 461
           P Q+VH +R+PD
Sbjct: 55  PCQRVHSSRIPD 66


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 243,685
Number of Sequences: 438
Number of extensions: 5241
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28766349
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)