Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP13_F_D08
         (881 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_1044 - 8208126-8208230,8208468-8208536,8208640-8208711           44   1e-04

>06_01_1044 - 8208126-8208230,8208468-8208536,8208640-8208711
          Length = 81

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +1

Query: 364 MTFVPNWEEFEKAAEMLYLQDPINTRYSVKYSHSKGAFNVKITDNKKCLQY 516
           M +  +W+EF   +  L+   P  TRY VKY H +G   +K+TDN + + +
Sbjct: 1   MVYFDSWDEFVSKSVELFRNHPDTTRYVVKYRHCEGKLVLKVTDNHENIHW 51


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,698,129
Number of Sequences: 37544
Number of extensions: 241374
Number of successful extensions: 383
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 379
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 383
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2491484208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)