SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP12_F_P20
         (877 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       26   0.52 
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    22   6.5  

>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 25.8 bits (54), Expect = 0.52
 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 3/61 (4%)
 Frame = -3

Query: 200 FCFLRYRRAGWLNQVLTNLCQSLWKCXXXXXXXXXXXLT---SEFYHGKENNVKSKS*GX 30
           FC+ R   A W N V  NL  SL KC            T    EFY  +     S + G 
Sbjct: 538 FCYFRRNAATWKNAVRHNL--SLHKCFMRVENVKGAVWTVDEVEFYKRRPQRACSTTGGV 595

Query: 29  P 27
           P
Sbjct: 596 P 596


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +3

Query: 225 SSTSCSWAVTSY 260
           S + C+W +TSY
Sbjct: 66  SGSKCTWTITSY 77


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 200,794
Number of Sequences: 438
Number of extensions: 4113
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28402218
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -