BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP12_F_P06
(920 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 25 1.1
DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 3.4
>DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory
protein 6 protein.
Length = 251
Score = 24.6 bits (51), Expect = 1.1
Identities = 10/11 (90%), Positives = 11/11 (100%)
Frame = +2
Query: 251 LSNRFGEDEEA 283
LSNRFGE+EEA
Sbjct: 139 LSNRFGENEEA 149
>DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein.
Length = 822
Score = 23.0 bits (47), Expect = 3.4
Identities = 12/38 (31%), Positives = 18/38 (47%)
Frame = +3
Query: 147 YFSLFTEFWERL*KPKDRXTPASVP*GIQPWRLXCYRT 260
Y +F + + L KP+ R T GIQP+ + T
Sbjct: 440 YMEIFARWKDILEKPRQRGTLEGNNMGIQPYDSLLWHT 477
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,931
Number of Sequences: 336
Number of extensions: 2391
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 25754817
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -