Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP12_F_N19
         (789 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0367 - 20672776-20673550,20674097-20674320,20674626-206748...    30   2.4  

>05_04_0367 -
           20672776-20673550,20674097-20674320,20674626-20674843,
           20675133-20676534
          Length = 872

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 15/63 (23%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = -2

Query: 278 IXXRQNAIAVDGRHRHAAKRVRHFIKTF-WLVGCFVIKSHVLLQTKRNAVEKFTGPAQNR 102
           I  R + +  D  H H  K ++  ++ + +++ C   + H +L+TK + +    GP +N 
Sbjct: 593 ISRRIHILRDDELHPHLVKLIQGLVRMWKFILECHRKQFHAILETKSHVLIPKNGPERNS 652

Query: 101 SLT 93
            +T
Sbjct: 653 KIT 655


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,700,438
Number of Sequences: 37544
Number of extensions: 192972
Number of successful extensions: 353
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 332
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 343
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2127163404
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)