Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP12_F_M02
         (825 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    28   0.12 
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    22   7.9  

>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 27.9 bits (59), Expect = 0.12
 Identities = 10/35 (28%), Positives = 17/35 (48%)
 Frame = -2

Query: 485 APSTFTVKPSTSARERLDLLCFAFSNYFFCQELYQ 381
           +P+T    P     E +D LC    ++  C E+Y+
Sbjct: 447 SPATTAAPPQLPTEESVDALCNTLHHWHHCPEIYK 481


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 21.8 bits (44), Expect = 7.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 275 KVRWDPGF 298
           K+ WDPGF
Sbjct: 683 KIEWDPGF 690


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 194,128
Number of Sequences: 438
Number of extensions: 4497
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26338809
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)