SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP12_F_K08
         (869 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    23   3.7  
AF213012-1|AAG43568.1|  492|Apis mellifera acetylcholinesterase ...    22   8.5  
AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase ...    22   8.5  

>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 10/33 (30%), Positives = 19/33 (57%)
 Frame = -1

Query: 296 ETSAASFLVTSWL*AVAAWLTSTIANVRSPQPR 198
           +    +F+VTSWL  + +++   I  V +P+ R
Sbjct: 653 QPGVTAFIVTSWLGYMNSFVNPVIYTVFNPEFR 685


>AF213012-1|AAG43568.1|  492|Apis mellifera acetylcholinesterase
           protein.
          Length = 492

 Score = 21.8 bits (44), Expect = 8.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -2

Query: 220 TCARPSRGSVXP 185
           +C RPSRG+  P
Sbjct: 15  SCTRPSRGNAVP 26


>AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase
           protein.
          Length = 628

 Score = 21.8 bits (44), Expect = 8.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -2

Query: 220 TCARPSRGSVXP 185
           +C RPSRG+  P
Sbjct: 15  SCTRPSRGNAVP 26


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 234,480
Number of Sequences: 438
Number of extensions: 4800
Number of successful extensions: 8
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28159464
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -