Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP12_F_I10
         (879 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY745209-1|AAU93476.1|  167|Anopheles gambiae cytochrome P450 pr...    24   7.0  
AY070257-1|AAL59656.1|  217|Anopheles gambiae glutathione S-tran...    24   7.0  

>AY745209-1|AAU93476.1|  167|Anopheles gambiae cytochrome P450
           protein.
          Length = 167

 Score = 23.8 bits (49), Expect = 7.0
 Identities = 11/39 (28%), Positives = 23/39 (58%)
 Frame = -1

Query: 168 LG*KSCGGLSIIRLFSWCREGNSQ*KYSQETNNDRILKL 52
           +G ++C G +++R FS+    N   KY   +N+  ++K+
Sbjct: 107 IGKRTCIGQNLVRGFSFIIIANILQKYDVHSNDLSLIKM 145


>AY070257-1|AAL59656.1|  217|Anopheles gambiae glutathione
           S-transferase e8 protein.
          Length = 217

 Score = 23.8 bits (49), Expect = 7.0
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 271 ITLFVPFGVDRWP 309
           + +FVP   DRWP
Sbjct: 169 VAIFVPLPADRWP 181


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 564,511
Number of Sequences: 2352
Number of extensions: 9165
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 94266828
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)