BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP12_F_I10
(879 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 24 7.0
AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 24 7.0
>AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450
protein.
Length = 167
Score = 23.8 bits (49), Expect = 7.0
Identities = 11/39 (28%), Positives = 23/39 (58%)
Frame = -1
Query: 168 LG*KSCGGLSIIRLFSWCREGNSQ*KYSQETNNDRILKL 52
+G ++C G +++R FS+ N KY +N+ ++K+
Sbjct: 107 IGKRTCIGQNLVRGFSFIIIANILQKYDVHSNDLSLIKM 145
>AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione
S-transferase e8 protein.
Length = 217
Score = 23.8 bits (49), Expect = 7.0
Identities = 7/13 (53%), Positives = 9/13 (69%)
Frame = +1
Query: 271 ITLFVPFGVDRWP 309
+ +FVP DRWP
Sbjct: 169 VAIFVPLPADRWP 181
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 564,511
Number of Sequences: 2352
Number of extensions: 9165
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 94266828
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -