Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP12_F_G16
         (897 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.    23   9.5  
AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh...    23   9.5  

>AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.
          Length = 1133

 Score = 23.4 bits (48), Expect = 9.5
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -3

Query: 442 PSRNRYCINS 413
           P+R RYCINS
Sbjct: 11  PTRKRYCINS 20


>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion
            protein protein.
          Length = 1881

 Score = 23.4 bits (48), Expect = 9.5
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = -1

Query: 255  YSNWSNVFIKEQTRHARNPRNSFGTVSMDII 163
            Y N ++  +K +   A +P N  G +S DI+
Sbjct: 1183 YHNINDPIVKLRATDADDPTNGNGQLSFDIV 1213


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 625,669
Number of Sequences: 2352
Number of extensions: 13119
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 96747534
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)