Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP12_F_G14
         (828 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    24   2.0  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    24   2.0  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    24   2.0  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    23   3.4  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                23   4.6  

>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -3

Query: 415 SRPNTGRYSCSKV 377
           S+ NTG YSC KV
Sbjct: 221 SKTNTGEYSCLKV 233


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -3

Query: 415 SRPNTGRYSCSKV 377
           S+ NTG YSC KV
Sbjct: 221 SKTNTGEYSCLKV 233


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +3

Query: 183 NKWLLDSKVSNKAPRIEVFLLNRLFTEDTFQNKVN 287
           N W   S + N +  +E F  NRL   ++F+ KVN
Sbjct: 273 NTWEPISNLINCSDILEEFERNRLQLLESFKRKVN 307


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 23.0 bits (47), Expect = 3.4
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)
 Frame = +3

Query: 594 NHHLVFVNSGFTKPR-SYRYWDAK--TRGIDFDGFI 692
           NHH +  +SGF   R   RY+  +     +DFD F+
Sbjct: 285 NHHAILGHSGFLCERHQKRYFFGRDSVDHVDFDEFL 320


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 22.6 bits (46), Expect = 4.6
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +1

Query: 331 YCPSFVRWKN 360
           YCP +++W N
Sbjct: 473 YCPRYIKWTN 482


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 217,829
Number of Sequences: 438
Number of extensions: 5125
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26460186
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)