Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP11_F_P23
         (956 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U29082-7|AAA68404.3|  319|Caenorhabditis elegans Hypothetical pr...    29   6.5  

>U29082-7|AAA68404.3|  319|Caenorhabditis elegans Hypothetical
           protein C14F5.4 protein.
          Length = 319

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 3/64 (4%)
 Frame = +3

Query: 174 TNQPAMPNLEVVSRVASIPIVVSG---IGVTEKLYFKIRESNPLFRWSMSLGEKSLATGI 344
           TN+ A   L     V S    VSG   + +  K YF  ++S+PL +  + LG  ++A  I
Sbjct: 127 TNRNAKSTLTTKDLVVSYSTAVSGALAMAIGLKTYFAKKQSSPLAQRLVPLGAVAVANAI 186

Query: 345 QLAL 356
            + +
Sbjct: 187 NIPM 190


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,358,132
Number of Sequences: 27780
Number of extensions: 434237
Number of successful extensions: 1146
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1082
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1146
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2486134266
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)