Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP11_F_N06
         (947 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1739.09c |cox13||cytochrome c oxidase subunit VIa|Schizosacc...    57   3e-09

>SPCC1739.09c |cox13||cytochrome c oxidase subunit
           VIa|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 130

 Score = 57.2 bits (132), Expect = 3e-09
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 4/69 (5%)
 Frame = +2

Query: 221 WKRMSFFVAFPAIALGMLNAYLAH--QEEH--HERPPFVPYEYMRIRTKRFPWGDGQKSL 388
           WK++++++  PA+ L   NAY  +   +EH  H       Y +  +R K++PWGDG K+L
Sbjct: 57  WKKVTYYIGGPALILASANAYYIYCKHQEHAKHVEDTDPGYSFENLRFKKYPWGDGSKTL 116

Query: 389 FHNPHVNAL 415
           F N  VN L
Sbjct: 117 FWNDKVNHL 125


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,766,742
Number of Sequences: 5004
Number of extensions: 49336
Number of successful extensions: 99
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 98
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 98
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 483319012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)