SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP11_F_H22
         (942 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   3.0  
AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.       23   4.0  

>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.4 bits (48), Expect = 3.0
 Identities = 20/76 (26%), Positives = 30/76 (39%)
 Frame = -1

Query: 759 EKRRAPNTQTASPRALADSLMQKNLPHLPLNLKHKMNAIVVVNLFIAAYNGYK*SNSITN 580
           E RR P   +  PR    S   K+LP   L+ K   +  ++    +A  N +  +  +T 
Sbjct: 53  EPRRNPGPGSKGPRDFPRSHRFKSLPRCQLSNKRDRSRELIKAAILA--NDFMKNLELTQ 110

Query: 579 FTNKAFFSLHSSCGLS 532
                   LH SC  S
Sbjct: 111 IRRDR--GLHVSCSFS 124


>AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.
          Length = 349

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 311 YSLYGLIQLKWF 276
           YSL+G+I + WF
Sbjct: 204 YSLFGMIMMYWF 215


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 225,680
Number of Sequences: 438
Number of extensions: 4432
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 30839445
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -