Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP11_F_G03
         (910 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U97007-6|AAB52296.3|  468|Caenorhabditis elegans Hypothetical pr...    32   0.49 

>U97007-6|AAB52296.3|  468|Caenorhabditis elegans Hypothetical
           protein ZC196.4 protein.
          Length = 468

 Score = 32.3 bits (70), Expect = 0.49
 Identities = 21/67 (31%), Positives = 33/67 (49%)
 Frame = +1

Query: 85  NKCMELEEILQSLKSRLNHVVLDENIVLSPEANSMEAQLEHDLDTDCQEDLSLQEFLELL 264
           N C E  E  Q +++  N +     I+     N  E + + D + +C+E     EFLE L
Sbjct: 164 NICDEFLENYQKMENEHNEMTSKYQIL---GENKSELKEQDDSEKECEEQNG--EFLEKL 218

Query: 265 HSQNKIN 285
            +QNK+N
Sbjct: 219 ENQNKVN 225


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,803,421
Number of Sequences: 27780
Number of extensions: 193754
Number of successful extensions: 400
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 397
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 400
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2318293978
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)