BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP11_F_D02
(938 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
04_04_1561 - 34435565-34436530,34437373-34437473,34438099-34438243 33 0.43
>04_04_1561 - 34435565-34436530,34437373-34437473,34438099-34438243
Length = 403
Score = 32.7 bits (71), Expect = 0.43
Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
Frame = +1
Query: 157 ISGHGNFPFIR-RLTLKQNINKCLGHVSAVSVVIIY 261
++ HGN P R R TLK + +C G +S S+ ++Y
Sbjct: 6 VTEHGNIPITRVRDTLKDGVVRCTGKISVSSLQVMY 41
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,930,134
Number of Sequences: 37544
Number of extensions: 300751
Number of successful extensions: 610
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 591
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 610
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2694390200
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -