SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP11_F_B23
         (927 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP22H7.02c |||RNA-binding protein Mrd1 |Schizosaccharomyces po...    27   3.8  
SPCC417.04 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual         26   6.6  

>SPBP22H7.02c |||RNA-binding protein Mrd1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 833

 Score = 27.1 bits (57), Expect = 3.8
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = -3

Query: 529 GFTAILQKITVRPASAGV--ATEMKLNTEMKFEKTLLIALQLMYC*TRKAYIRLVGGYGA 356
           GF     K+ ++ +  GV  A E++     K + T ++   L +  T+K    L+G YG 
Sbjct: 687 GFVLDGHKLEIKLSHQGVDAAAEVRKQDSSKPKGTKILIKNLPFEATKKDVQSLLGAYGQ 746

Query: 355 LKNVFV 338
           L++V V
Sbjct: 747 LRSVRV 752


>SPCC417.04 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 180

 Score = 26.2 bits (55), Expect = 6.6
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -2

Query: 161 CCSSRGFLFLFFF 123
           CCSS G LF FFF
Sbjct: 27  CCSSEGPLFYFFF 39


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,359,976
Number of Sequences: 5004
Number of extensions: 66741
Number of successful extensions: 156
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 154
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 156
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 469338710
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -