Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP10_F_N24
         (893 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY545000-1|AAS50159.2|  126|Apis mellifera profilin protein.           28   0.10 
AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive...    24   1.6  

>AY545000-1|AAS50159.2|  126|Apis mellifera profilin protein.
          Length = 126

 Score = 28.3 bits (60), Expect = 0.10
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = +1

Query: 169 RRYLERAGV--MDALTKVLVSLYEEPDKPEDALEYVRK 276
           R  L + GV  M     V+VSLYE+P +P+ A   V K
Sbjct: 79  RAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEK 116


>AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive
           opsin protein.
          Length = 371

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -2

Query: 271 VHIPRHLLVYP 239
           +HIP H LVYP
Sbjct: 31  IHIPEHWLVYP 41


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,712
Number of Sequences: 438
Number of extensions: 3348
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)