Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP09_F_F17
         (873 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-111|ABI31133.1|  403|Drosophila melanogaster CG41467-PB...    29   8.4  

>AE014297-111|ABI31133.1|  403|Drosophila melanogaster CG41467-PB,
           isoform B protein.
          Length = 403

 Score = 29.1 bits (62), Expect = 8.4
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = +3

Query: 486 TVVLEELPLLKYSEE---DSSGILITVRSSQEDSNTKKVAYVAILLSWGISISMENAIHL 656
           TVVL   P +K S         I + V+S     N  +V       +WG+ +++   +H+
Sbjct: 58  TVVLWPCPRMKISSNFLPSFEAISLAVQSISTKLNWSQVDIYIGDDNWGLGLAIAANLHV 117

Query: 657 PYMLERG 677
           PY +E G
Sbjct: 118 PYRIEIG 124


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,968,601
Number of Sequences: 53049
Number of extensions: 669563
Number of successful extensions: 1234
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1212
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1234
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4229643912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)