BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP07_F_P24
(912 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.7
>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
protein.
Length = 1370
Score = 22.2 bits (45), Expect = 6.7
Identities = 10/41 (24%), Positives = 20/41 (48%)
Frame = -2
Query: 437 SLKNVSIRLLIPLQNAML*SLITSRNHSVGSDYFTLIFILH 315
S+ + +PL N L ++ +VG+ F +F+L+
Sbjct: 370 SIDRIESNAFLPLYNLHTLELSDNKLRTVGAQLFNGLFVLN 410
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 237,413
Number of Sequences: 438
Number of extensions: 5010
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29630055
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -