SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP07_F_N24
         (894 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    27   0.17 
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    24   1.6  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                23   3.8  
Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1 p...    23   5.0  
AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone este...    22   6.6  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    22   6.6  
AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.           22   6.6  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    22   8.7  
DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    22   8.7  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    22   8.7  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    22   8.7  

>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 27.5 bits (58), Expect = 0.17
 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 5/65 (7%)
 Frame = -1

Query: 213 NASVGAAARIPLRSS*FLCTGACRASGYSDKKQGNDNFTNIFNTSARYD-----ATQTNS 49
           N S+       +R S  +C G  R+  +  +     N  NI+N S+R +      TQ+N 
Sbjct: 337 NPSITRTGLSSVRDSSIICGGNKRSQVFRGRDANRQNSCNIYNASSRMENNLRGETQSNY 396

Query: 48  KNLKE 34
           + +++
Sbjct: 397 REMEK 401


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 10/30 (33%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = -1

Query: 774 PKICYNIFKQHKTQ*FY-FNKYNNHDYSKY 688
           PKI  ++   +K   +  +N YNN++Y+ Y
Sbjct: 312 PKIISSLSNNYKYSNYNNYNNYNNNNYNNY 341


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 23.0 bits (47), Expect = 3.8
 Identities = 12/45 (26%), Positives = 21/45 (46%)
 Frame = -1

Query: 363 HKQFSFNSRHIQVKRAVSDTVFCSYVSSWFCLVSSSLRCCIPCPP 229
           H+  S    H +    +S++ + SYV+S +   +     C P PP
Sbjct: 356 HQTQSLQHLHYRQPPTLSES-YSSYVNSMYASGAQFATPCTPSPP 399


>Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1
           protein.
          Length = 402

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = -2

Query: 161 FAPEHVERRDIPTRSKGTIISLTFLTRAHAMTPRK 57
           +A +HV+     T+   T ++ +F+ + HA  P K
Sbjct: 218 YAQKHVKSIRAVTKLPDTSMAKSFVRKVHATKPPK 252


>AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone
           esterase protein.
          Length = 567

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -2

Query: 464 NPNEGTINYLH 432
           NPNE +++YLH
Sbjct: 516 NPNEKSLHYLH 526


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -1

Query: 723 FNKYNNHDYSKY 688
           +N YNN++Y+ Y
Sbjct: 338 YNNYNNNNYNNY 349


>AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.
          Length = 567

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -2

Query: 464 NPNEGTINYLH 432
           NPNE +++YLH
Sbjct: 516 NPNEKSLHYLH 526


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 98  YNNYNKHNYNK 108


>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = -1

Query: 105 NFTNIFNTSARYDATQTNSKNLKEF 31
           +F ++FN +AR    +   +N KEF
Sbjct: 152 SFIDLFNANARSVVEKMRKENGKEF 176


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 331 YNNYNKHNYNK 341


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 723 FNKYNNHDYSK 691
           +N YN H+Y+K
Sbjct: 331 YNNYNKHNYNK 341


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 224,894
Number of Sequences: 438
Number of extensions: 4966
Number of successful extensions: 30
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -