SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP07_F_L01
         (953 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    23   5.4  
AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.          22   9.4  

>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 22.6 bits (46), Expect = 5.4
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = -2

Query: 610 ILVVCYVDLLPLFRVNIWS 554
           + ++C+   LP F VN+WS
Sbjct: 343 VFIICW---LPFFVVNLWS 358


>AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.
          Length = 147

 Score = 21.8 bits (44), Expect = 9.4
 Identities = 15/56 (26%), Positives = 22/56 (39%)
 Frame = +2

Query: 191 CSKCXASFFLEYIXYXXXXXXXHNARKR*TLCXAYQRFPEEVVVRARISSHPTPPR 358
           C KC  +   + +         H A+ +  +  A +  P    V   ISS P PPR
Sbjct: 6   CEKCKITANRQQVMRQNMKLKRHLAQDKVKVRVAEEVDPLPFGVENTISSVPQPPR 61


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,975
Number of Sequences: 438
Number of extensions: 3840
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 31323201
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -