SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP07_F_K06
         (857 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    23   4.8  
DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex det...    22   8.3  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    22   8.3  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    22   8.3  

>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 22.6 bits (46), Expect = 4.8
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -1

Query: 515 KFTLTSSCKYLSILCFSMNSYELLPY 438
           KFT  S    + I+C+ + SY   PY
Sbjct: 814 KFTSASDVWSMGIVCWEVMSYGERPY 839


>DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 21.8 bits (44), Expect = 8.3
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 381 NNIWSYNNTNFYN 419
           +NI +YNN N YN
Sbjct: 91  SNISNYNNNNNYN 103


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.8 bits (44), Expect = 8.3
 Identities = 11/38 (28%), Positives = 18/38 (47%)
 Frame = +3

Query: 309 KNKNMKIILKKYENMSSICFLEEKNNIWSYNNTNFYNI 422
           +++  KII     N +   +    NN  +YN   +YNI
Sbjct: 75  RSREPKIISSLSNNYNYSNYNNYNNNYNNYNKKLYYNI 112


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 21.8 bits (44), Expect = 8.3
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 381 NNIWSYNNTNFYN 419
           +NI +YNN N YN
Sbjct: 329 SNISNYNNNNNYN 341


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 226,645
Number of Sequences: 438
Number of extensions: 4845
Number of successful extensions: 12
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27673956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -