BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP06_F_K19
(879 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
08_01_0250 - 2053568-2054021,2054413-2054801 29 4.9
>08_01_0250 - 2053568-2054021,2054413-2054801
Length = 280
Score = 29.1 bits (62), Expect = 4.9
Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
Frame = -2
Query: 287 NFYSISVCTFPLAPP-CARPNCLTHKRWSVPCHASRPDVCRI*HPSC 150
N Y+++ CT LAPP CA+ T +++ C + + C+I + SC
Sbjct: 204 NVYALAQCTRDLAPPLCAQCLSTTVSKFAEACGSGQG--CQIDYSSC 248
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,094,431
Number of Sequences: 37544
Number of extensions: 410955
Number of successful extensions: 867
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 840
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 867
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2479731924
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -