Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP05_F_P13
         (905 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               23   5.1  
EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    22   6.7  

>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.6 bits (46), Expect = 5.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 269 KWFFPRWAQAL 301
           K+FFP+W Q L
Sbjct: 648 KFFFPKWLQVL 658


>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
           protein.
          Length = 1010

 Score = 22.2 bits (45), Expect = 6.7
 Identities = 17/66 (25%), Positives = 26/66 (39%)
 Frame = +2

Query: 479 VVTVQGVPLSSYMEDLLTNKISLNAGKGRQAIEWVIGKFDTEIKELASSACKSTDELLSQ 658
           V+T QGV LS Y    +     L  G GR       G      ++L  +A    + +   
Sbjct: 359 VITPQGVFLSLYQPQGMNILGDLIEGTGRSVNPRYYGSLQAAARKLLGNA-PEVENIWDY 417

Query: 659 TKKSID 676
           T  S++
Sbjct: 418 TPSSLE 423


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 228,200
Number of Sequences: 438
Number of extensions: 4912
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29388177
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)