SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP05_F_P09
         (1007 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    24   2.5  
AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.    24   2.5  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    22   7.6  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.8 bits (49), Expect = 2.5
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -2

Query: 817  PPPPPPP 797
            PPPPPPP
Sbjct: 1355 PPPPPPP 1361



 Score = 23.8 bits (49), Expect = 2.5
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -2

Query: 817  PPPPPPP 797
            PPPPPPP
Sbjct: 1356 PPPPPPP 1362


>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score = 23.8 bits (49), Expect = 2.5
 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = -2

Query: 172 KEXVRFLKFPPXCPFQPVGKG-HPNQIGTF 86
           KE  RFL+    C F P G+G + N   TF
Sbjct: 188 KEGDRFLQAANACRFWPTGRGIYHNDDKTF 217


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 648 PPXXXXPPPPP 616
           PP    PPPPP
Sbjct: 338 PPKPAPPPPPP 348



 Score = 22.2 bits (45), Expect = 7.6
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -2

Query: 646 PPXXXXPPPPP 614
           PP    PPPPP
Sbjct: 338 PPKPAPPPPPP 348


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 244,517
Number of Sequences: 438
Number of extensions: 7558
Number of successful extensions: 28
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 33500103
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -