Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP05_F_N24
         (919 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0116 + 12762009-12763021,12763421-12763436                       31   1.7  

>08_02_0116 + 12762009-12763021,12763421-12763436
          Length = 342

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -3

Query: 866 IRLQLXTLRSSLFSISV*FSTSXPHIFSLIDLPCFRSISFSLSYRAYDVHLYLSCLVYVR 687
           ++  L TL   +F  S   +     IF+  DLPC R++ F +     D+ +Y    VY+ 
Sbjct: 194 LQSSLNTLGYIMFDDSCELNCLKDKIFAHSDLPCSRNVIFHIFGEYNDLGIYFVHRVYIC 253

Query: 686 LDIPAKV 666
            D+   V
Sbjct: 254 SDLKLPV 260


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,423,411
Number of Sequences: 37544
Number of extensions: 371420
Number of successful extensions: 692
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 670
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 692
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2612387020
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)