BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP05_F_J04
(917 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr 1|||M... 27 2.8
>SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr
1|||Manual
Length = 1115
Score = 27.5 bits (58), Expect = 2.8
Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
Frame = +3
Query: 375 LPDGNSWCPDCVEAEP-VVRHYLSELDKSIIFVYVDVGDREYWK 503
LP G WC C+ +P ++R ++ L +F+ V E+WK
Sbjct: 688 LPPG--WCEYCLAHQPFLLRSFIRSL-PDCLFINTQVKHHEHWK 728
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,495,987
Number of Sequences: 5004
Number of extensions: 72002
Number of successful extensions: 154
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 146
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 154
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 466510270
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -